Lineage for d3cb2a2 (3cb2 A:247-446)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1657490Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1657767Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 1657962Family d.79.2.0: automated matches [227141] (1 protein)
    not a true family
  6. 1657963Protein automated matches [226843] (5 species)
    not a true protein
  7. 1657971Species Human (Homo sapiens) [TaxId:9606] [224983] (3 PDB entries)
  8. 1657972Domain d3cb2a2: 3cb2 A:247-446 [208845]
    Other proteins in same PDB: d3cb2a1, d3cb2b1
    automated match to d1jffb2
    complexed with gdp

Details for d3cb2a2

PDB Entry: 3cb2 (more details), 2.3 Å

PDB Description: Crystal structure of human gamma-tubulin bound to GDP
PDB Compounds: (A:) Tubulin gamma-1 chain

SCOPe Domain Sequences for d3cb2a2:

Sequence, based on SEQRES records: (download)

>d3cb2a2 d.79.2.0 (A:247-446) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gymnndligliasliptprlhflmtgytplttdqsvasvrkttvldvmrrllqpknvmvs
tgrdrqtnhcyiailniiqgevdptqvhkslqrirerklanfipwgpasiqvalsrkspy
lpsahrvsglmmanhtsisslfertcrqydklrkreafleqfrkedmfkdnfdemdtsre
ivqqlideyhaatrpdyisw

Sequence, based on observed residues (ATOM records): (download)

>d3cb2a2 d.79.2.0 (A:247-446) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gymnndligliasliptprlhflmtgytpltsvrkttvldvmrrllqpknvmvstgrdtn
hcyiailniiqgevdptqvhkslqrirerklanfipwgpasiqvalsrkspyrvsglmma
nhtsisslfertcrqydklrkreafleqfrkedmfkdnfdemdtsreivqqlideyhaat
rpdyisw

SCOPe Domain Coordinates for d3cb2a2:

Click to download the PDB-style file with coordinates for d3cb2a2.
(The format of our PDB-style files is described here.)

Timeline for d3cb2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cb2a1