Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.0: automated matches [227141] (1 protein) not a true family |
Protein automated matches [226843] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224983] (3 PDB entries) |
Domain d3cb2a2: 3cb2 A:247-446 [208845] Other proteins in same PDB: d3cb2a1, d3cb2b1 automated match to d1jffb2 complexed with gdp |
PDB Entry: 3cb2 (more details), 2.3 Å
SCOPe Domain Sequences for d3cb2a2:
Sequence, based on SEQRES records: (download)
>d3cb2a2 d.79.2.0 (A:247-446) automated matches {Human (Homo sapiens) [TaxId: 9606]} gymnndligliasliptprlhflmtgytplttdqsvasvrkttvldvmrrllqpknvmvs tgrdrqtnhcyiailniiqgevdptqvhkslqrirerklanfipwgpasiqvalsrkspy lpsahrvsglmmanhtsisslfertcrqydklrkreafleqfrkedmfkdnfdemdtsre ivqqlideyhaatrpdyisw
>d3cb2a2 d.79.2.0 (A:247-446) automated matches {Human (Homo sapiens) [TaxId: 9606]} gymnndligliasliptprlhflmtgytpltsvrkttvldvmrrllqpknvmvstgrdtn hcyiailniiqgevdptqvhkslqrirerklanfipwgpasiqvalsrkspyrvsglmma nhtsisslfertcrqydklrkreafleqfrkedmfkdnfdemdtsreivqqlideyhaat rpdyisw
Timeline for d3cb2a2: