PDB entry 3cb2

View 3cb2 on RCSB PDB site
Description: Crystal structure of human gamma-tubulin bound to GDP
Class: structural protein, hydrolase
Keywords: tubulin, lattice, microtubule, nucleation, GTPase, lateral interaction, STRUCTURAL PROTEIN, HYDROLASE
Deposited on 2008-02-21, released 2008-06-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.189
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tubulin gamma-1 chain
    Species: HOMO SAPIENS
    Gene: TUBG1, TUBG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23258
      • conflict (34)
      • conflict (201)
    Domains in SCOPe 2.04: d3cb2a1, d3cb2a2
  • Chain 'B':
    Compound: Tubulin gamma-1 chain
    Species: HOMO SAPIENS
    Gene: TUBG1, TUBG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23258
      • conflict (34)
      • conflict (201)
    Domains in SCOPe 2.04: d3cb2b1, d3cb2b2
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cb2A (A:)
    mpreiitlqlgqcgnqigfefwkqlcaehgispeaiveefategtdrkdvffyqaddehy
    ipravlldleprvihsilnspyaklynpeniylsehgggagnnwasgfsqgekihedifd
    iidreadgsdslegfvlchsiaggtgsglgsyllerlndrypkklvqtysvfpnqdemsd
    vvvqpynslltlkrltqnadclvvldntalnriatdrlhiqnpsfsqinqlvstimsast
    ttlrypgymnndligliasliptprlhflmtgytplttdqsvasvrkttvldvmrrllqp
    knvmvstgrdrqtnhcyiailniiqgevdptqvhkslqrirerklanfipwgpasiqval
    srkspylpsahrvsglmmanhtsisslfertcrqydklrkreafleqfrkedmfkdnfde
    mdtsreivqqlideyhaatrpdyiswgtqeqvdvdggqkliseedlllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cb2A (A:)
    preiitlqlgqcgnqigfefwkqlcaehgispeaiveefategtdrkdvffyqaddehyi
    pravlldleprvihsilnspyaklynpeniylsehgggagnnwasgfsqgekihedifdi
    idreadgsdslegfvlchsiaggtgsglgsyllerlndrypkklvqtysvfpnqdemsdv
    vvqpynslltlkrltqnadclvvldntalnriatdrlhiqnpsfsqinqlvstimsastt
    tlrypgymnndligliasliptprlhflmtgytpltsvrkttvldvmrrllqpknvmvst
    grdtnhcyiailniiqgevdptqvhkslqrirerklanfipwgpasiqvalsrkspyrvs
    glmmanhtsisslfertcrqydklrkreafleqfrkedmfkdnfdemdtsreivqqlide
    yhaatrpdyisw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cb2B (B:)
    mpreiitlqlgqcgnqigfefwkqlcaehgispeaiveefategtdrkdvffyqaddehy
    ipravlldleprvihsilnspyaklynpeniylsehgggagnnwasgfsqgekihedifd
    iidreadgsdslegfvlchsiaggtgsglgsyllerlndrypkklvqtysvfpnqdemsd
    vvvqpynslltlkrltqnadclvvldntalnriatdrlhiqnpsfsqinqlvstimsast
    ttlrypgymnndligliasliptprlhflmtgytplttdqsvasvrkttvldvmrrllqp
    knvmvstgrdrqtnhcyiailniiqgevdptqvhkslqrirerklanfipwgpasiqval
    srkspylpsahrvsglmmanhtsisslfertcrqydklrkreafleqfrkedmfkdnfde
    mdtsreivqqlideyhaatrpdyiswgtqeqvdvdggqkliseedlllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cb2B (B:)
    reiitlqlgqcgnqigfefwkqlcaehgispeaiveefategtdrkdvffyqaddehyip
    ravlldleprvihsilnspyaklynpeniylsehgagnnwasgfsqgekihedifdiidr
    eadgsdslegfvlchsiaggtgsglgsyllerlndrypkklvqtysvfpnqdemsdvvvq
    pynslltlkrltqnadclvvldntalnriatdrlhiqnpsfsqinqlvstimsastttlr
    ypgymnndligliasliptprlhflmtgytpltkttvldvmrrllqpknvmvsttnhcyi
    ailniiqgevdptqvhkslqrirerlanfipwgpasiqvalsrkspylprvsglmmanht
    sisslfertcrqydklrkreafleqfrkedmfkdnfdemdtsreivqqlideyhaatrpd
    yisw