| Class b: All beta proteins [48724] (177 folds) |
| Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) ![]() |
| Family b.42.2.0: automated matches [227190] (1 protein) not a true family |
| Protein automated matches [226913] (9 species) not a true protein |
| Species Sambucus nigra [TaxId:4202] [225559] (8 PDB entries) |
| Domain d3c9za1: 3c9z A:1-128 [208821] automated match to d1onkb1 complexed with act, nag, so4 |
PDB Entry: 3c9z (more details), 1.35 Å
SCOPe Domain Sequences for d3c9za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c9za1 b.42.2.0 (A:1-128) automated matches {Sambucus nigra [TaxId: 4202]}
tsftrnivgrdglcvdvrngydtdgtplqlwpcgtqrnqrwtfdsddtirsmgkcmtang
lnngsnivifncstaaenaikwevpidgsiinpssglvmtapraasrtillledniyaas
qgwtvtnn
Timeline for d3c9za1: