Lineage for d3c9za1 (3c9z A:1-128)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1316302Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1316646Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 1316851Family b.42.2.0: automated matches [227190] (1 protein)
    not a true family
  6. 1316852Protein automated matches [226913] (4 species)
    not a true protein
  7. 1316856Species Sambucus nigra [TaxId:4202] [225559] (8 PDB entries)
  8. 1316857Domain d3c9za1: 3c9z A:1-128 [208821]
    automated match to d1onkb1
    complexed with act, nag, so4

Details for d3c9za1

PDB Entry: 3c9z (more details), 1.35 Å

PDB Description: sambucus nigra agglutinin ii (sna-ii), tetragonal crystal form
PDB Compounds: (A:) Agglutinin II

SCOPe Domain Sequences for d3c9za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c9za1 b.42.2.0 (A:1-128) automated matches {Sambucus nigra [TaxId: 4202]}
tsftrnivgrdglcvdvrngydtdgtplqlwpcgtqrnqrwtfdsddtirsmgkcmtang
lnngsnivifncstaaenaikwevpidgsiinpssglvmtapraasrtillledniyaas
qgwtvtnn

SCOPe Domain Coordinates for d3c9za1:

Click to download the PDB-style file with coordinates for d3c9za1.
(The format of our PDB-style files is described here.)

Timeline for d3c9za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3c9za2