Lineage for d3byia1 (3byi A:262-471)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338321Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 2338322Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) (S)
  5. 2338378Family a.116.1.0: automated matches [227202] (1 protein)
    not a true family
  6. 2338379Protein automated matches [226932] (4 species)
    not a true protein
  7. 2338383Species Human (Homo sapiens) [TaxId:9606] [225230] (9 PDB entries)
  8. 2338387Domain d3byia1: 3byi A:262-471 [208745]
    Other proteins in same PDB: d3byia2, d3byib2
    automated match to d1grnb_

Details for d3byia1

PDB Entry: 3byi (more details), 2.25 Å

PDB Description: Crystal structure of human Rho GTPase activating protein 15 (ARHGAP15)
PDB Compounds: (A:) Rho GTPase activating protein 15

SCOPe Domain Sequences for d3byia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3byia1 a.116.1.0 (A:262-471) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpslktlqekglikdqifgshlhkvcerenstvpwfvkqcieavekrgldvdgiyrvsgn
latiqklrfivnqeeklnlddsqwedihvvtgalkmffrelpeplfpysffeqfveaikk
qdnntrieavkslvqklpppnrdtmkvlfghltkivakasknlmstqslgivfgptllra
enetgnmaihmvyqnqiaelmlseyskifg

SCOPe Domain Coordinates for d3byia1:

Click to download the PDB-style file with coordinates for d3byia1.
(The format of our PDB-style files is described here.)

Timeline for d3byia1: