SCOPe 2.06: Domain d3byia1: 3byi A:262-471

Lineage for d3byia1 (3byi A:262-471)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
   multihelical

4. Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families)

5. Family a.116.1.0: automated matches [227202] (1 protein)
   not a true family

6. Protein automated matches [226932] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225230] (9 PDB entries)

8. Domain d3byia1: 3byi A:262-471 [208745]
   Other proteins in same PDB: d3byia2, d3byib2
   automated match to d1grnb_

Details for d3byia1

PDB Entry: 3byi, 2.25 Å

PDB Description: Crystal structure of human Rho GTPase activating protein 15 (ARHGAP15)

PDB Compounds: (A:) Rho GTPase activating protein 15

SCOPe Domain Sequences for d3byia1:

Sequence; same for both SEQRES and ATOM records:

>d3byia1 a.116.1.0 (A:262-471) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpslktlqekglikdqifgshlhkvcerenstvpwfvkqcieavekrgldvdgiyrvsgn
latiqklrfivnqeeklnlddsqwedihvvtgalkmffrelpeplfpysffeqfveaikk
qdnntrieavkslvqklpppnrdtmkvlfghltkivakasknlmstqslgivfgptllra
enetgnmaihmvyqnqiaelmlseyskifg

Timeline for d3byia1:

• d3byia1 first appeared in SCOPe 2.03, called d3byia_
  
• d3byia1 was called d3byia_ in SCOPe 2.05
  
• d3byia1 appears in SCOPe 2.07
  
• d3byia1 appears in the current release, SCOPe 2.08