Lineage for d3bwqc_ (3bwq C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2823225Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 2823667Family b.121.6.0: automated matches [227135] (1 protein)
    not a true family
  6. 2823668Protein automated matches [226836] (7 species)
    not a true protein
  7. 2823744Species Simian virus 40 [TaxId:10633] [225418] (2 PDB entries)
  8. 2823752Domain d3bwqc_: 3bwq C: [208735]
    automated match to d1vpsa_

Details for d3bwqc_

PDB Entry: 3bwq (more details), 2.3 Å

PDB Description: structure of free sv40 vp1 pentamer
PDB Compounds: (C:) Capsid protein VP1

SCOPe Domain Sequences for d3bwqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bwqc_ b.121.6.0 (C:) automated matches {Simian virus 40 [TaxId: 10633]}
gievlgvktgvdsftevecflnpqmgnpdehqkglskslaaekqftddspdkeqlpcysv
ariplpninedltcgnilmweavtvktevigvtamlnlhsgtqkthengagkpiqgsnfh
ffavggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdhkavldkdnaypvecwvp
dpsknentryfgtytggenvppvlhitntattvlldeqgvgplckadslyvsavdicglf
tntsgtqqwkglpryfkitlrkrsvkn

SCOPe Domain Coordinates for d3bwqc_:

Click to download the PDB-style file with coordinates for d3bwqc_.
(The format of our PDB-style files is described here.)

Timeline for d3bwqc_: