Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) |
Family b.121.6.0: automated matches [227135] (1 protein) not a true family |
Protein automated matches [226836] (7 species) not a true protein |
Species Simian virus 40 [TaxId:10633] [225418] (2 PDB entries) |
Domain d3bwqd_: 3bwq D: [208736] automated match to d1vpsa_ |
PDB Entry: 3bwq (more details), 2.3 Å
SCOPe Domain Sequences for d3bwqd_:
Sequence, based on SEQRES records: (download)
>d3bwqd_ b.121.6.0 (D:) automated matches {Simian virus 40 [TaxId: 10633]} gievlgvktgvdsftevecflnpqmgnpdehqkglskslaaekqftddspdkeqlpcysv ariplpninedltcgnilmweavtvktevigvtamlnlhsgtqkthengagkpiqgsnfh ffavggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdhkavldkdnaypvecwvp dpsknentryfgtytggenvppvlhitntattvlldeqgvgplckadslyvsavdicglf tntsgtqqwkglpryfkitlrkrsvkn
>d3bwqd_ b.121.6.0 (D:) automated matches {Simian virus 40 [TaxId: 10633]} gievlgvktgsftevecflnpqmgnpdehqkglskslaaekqftddspdkeqlpcysvar iplpninedltcgnilmweavtvktevigvtamlnlhsgtqkthengagkpiqgsnfhff avggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdhkavldkdnaypvecwvpdp sknentryfgtytggenvppvlhitntattvlldeqgvgplckadslyvsavdicglftn tsgtqqwkglpryfkitlrkrsvkn
Timeline for d3bwqd_:
View in 3D Domains from other chains: (mouse over for more information) d3bwqa_, d3bwqb_, d3bwqc_, d3bwqe_ |