SCOP 1.61: Domain d1c16c1: 1c16 C:181-276

Lineage for d1c16c1 (1c16 C:181-276)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein MHC I homolog [48967] (3 species)

7. Species Mouse (Mus musculus), t22 [TaxId:10090] [48969] (1 PDB entry)

8. Domain d1c16c1: 1c16 C:181-276 [20858]
   Other proteins in same PDB: d1c16a2, d1c16c2, d1c16e2, d1c16g2

Details for d1c16c1

PDB Entry: 1c16, 3.1 Å

PDB Description: crystal structure analysis of the gamma/delta t cell ligand t22

SCOP Domain Sequences for d1c16c1:

Sequence; same for both SEQRES and ATOM records:

>d1c16c1 b.1.1.2 (C:181-276) MHC I homolog {Mouse (Mus musculus), t22}
rsdppkahvtrhprpegdvtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
fqkwaavvvplgkeqsytchvyheglpeplilrwgg

Timeline for d1c16c1:

• d1c16c1 first appeared (with stable ids) in SCOP 1.55
  
• d1c16c1 appears in SCOP 1.59
  
• d1c16c1 appears in SCOP 1.63
  
• d1c16c1 appears in the current release, SCOPe 2.08