Lineage for d1c16c1 (1c16 C:181-276)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 221963Protein MHC I homolog [48967] (3 species)
    gamma, delta T-cell ligand
  7. 221969Species Mouse (Mus musculus), t22 [TaxId:10090] [48969] (1 PDB entry)
  8. 221972Domain d1c16c1: 1c16 C:181-276 [20858]
    Other proteins in same PDB: d1c16a2, d1c16c2, d1c16e2, d1c16g2

Details for d1c16c1

PDB Entry: 1c16 (more details), 3.1 Å

PDB Description: crystal structure analysis of the gamma/delta t cell ligand t22

SCOP Domain Sequences for d1c16c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c16c1 b.1.1.2 (C:181-276) MHC I homolog {Mouse (Mus musculus), t22}
rsdppkahvtrhprpegdvtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
fqkwaavvvplgkeqsytchvyheglpeplilrwgg

SCOP Domain Coordinates for d1c16c1:

Click to download the PDB-style file with coordinates for d1c16c1.
(The format of our PDB-style files is described here.)

Timeline for d1c16c1: