Lineage for d1bz9a1 (1bz9 A:182-274)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 288747Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 288830Species Mouse (Mus musculus) [TaxId:10090] [88606] (49 PDB entries)
  8. 288887Domain d1bz9a1: 1bz9 A:182-274 [20829]
    Other proteins in same PDB: d1bz9a2, d1bz9b_

Details for d1bz9a1

PDB Entry: 1bz9 (more details), 2.8 Å

PDB Description: crystal structure of murine class i mhc h2-db complexed with a synthetic peptide p1027

SCOP Domain Sequences for d1bz9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bz9a1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus)}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

SCOP Domain Coordinates for d1bz9a1:

Click to download the PDB-style file with coordinates for d1bz9a1.
(The format of our PDB-style files is described here.)

Timeline for d1bz9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bz9a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1bz9b_