SCOP 1.55: Domain d1bz9a1: 1bz9 A:182-274

Lineage for d1bz9a1 (1bz9 A:182-274)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)

7. Species Mouse (Mus musculus), H-2DB [TaxId:10090] [48960] (5 PDB entries)

8. Domain d1bz9a1: 1bz9 A:182-274 [20829]
   Other proteins in same PDB: d1bz9a2

Details for d1bz9a1

PDB Entry: 1bz9, 2.8 Å

PDB Description: crystal structure of murine class i mhc h2-db complexed with a synthetic peptide p1027

SCOP Domain Sequences for d1bz9a1:

Sequence; same for both SEQRES and ATOM records:

>d1bz9a1 b.1.1.2 (A:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2DB}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

Timeline for d1bz9a1:

• d1bz9a1 appears in SCOP 1.57
  
• d1bz9a1 appears in the current release, SCOPe 2.08