Lineage for d1bz9a1 (1bz9 A:182-274)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2349424Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2349724Species Mouse (Mus musculus) [TaxId:10090] [88606] (110 PDB entries)
    Uniprot P01901 22-299
  8. 2349862Domain d1bz9a1: 1bz9 A:182-274 [20829]
    Other proteins in same PDB: d1bz9a2, d1bz9b2, d1bz9b3

Details for d1bz9a1

PDB Entry: 1bz9 (more details), 2.8 Å

PDB Description: crystal structure of murine class i mhc h2-db complexed with a synthetic peptide p1027
PDB Compounds: (A:) protein (class I histocompatibility antigen)

SCOPe Domain Sequences for d1bz9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bz9a1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

SCOPe Domain Coordinates for d1bz9a1:

Click to download the PDB-style file with coordinates for d1bz9a1.
(The format of our PDB-style files is described here.)

Timeline for d1bz9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bz9a2