Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) |
Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
Protein automated matches [190418] (31 species) not a true protein |
Species Pseudomonas sp. [TaxId:1007495] [226382] (3 PDB entries) |
Domain d2yhea1: 2yhe A:30-538 [207591] Other proteins in same PDB: d2yhea2, d2yhea3, d2yheb2, d2yheb3, d2yhec2, d2yhec3, d2yhed2, d2yhed3, d2yhee2, d2yhee3, d2yhef2, d2yhef3 automated match to d2cfua2 complexed with so4, zn |
PDB Entry: 2yhe (more details), 2.7 Å
SCOPe Domain Sequences for d2yhea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yhea1 d.157.1.0 (A:30-538) automated matches {Pseudomonas sp. [TaxId: 1007495]} esldskpasaitaaknaevlknlpfadreefeaakrgliapfsgqiknaegqvvwdmgay qflndkdaadtvnpslwrqaqlnniaglfevmpklyqvrgldpanmtiiegdsglvlidt lttaetaraaldlyfqhrpkkpivavvyshshidhfggargiideadvkagkvkvfapsg fmehavsenilagtamarrgqyqsgvmvprgaqaqvdsglfkttatnatntlvapnvlie kpyerhtvdgvelefqltlgseapsdmniylpqfkvlntadnappamhnlltprgaevrd akawagyidaslekygdrtdvliqqhnwpvwggdkvrtyladqrdmyaflnnralnlmnk gltlheiaaevsklpgeldrkwylrsyygalstnlravyqrylgfydgnpanldpfppve agkryveamggadavlkqmraaidkgdyrwavqlgnhlvfadpankdaralqadameqlg yqtenalwrnmymtgamelrhgvptydsr
Timeline for d2yhea1: