Lineage for d2yhee1 (2yhe E:30-538)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2997604Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2997605Protein automated matches [190418] (31 species)
    not a true protein
  7. 2997981Species Pseudomonas sp. [TaxId:1007495] [226382] (3 PDB entries)
  8. 2997992Domain d2yhee1: 2yhe E:30-538 [207599]
    Other proteins in same PDB: d2yhea2, d2yhea3, d2yheb2, d2yheb3, d2yhec2, d2yhec3, d2yhed2, d2yhed3, d2yhee2, d2yhee3, d2yhef2, d2yhef3
    automated match to d2cfua2
    complexed with so4, zn

Details for d2yhee1

PDB Entry: 2yhe (more details), 2.7 Å

PDB Description: structure determination of the stereoselective inverting sec- alkylsulfatase pisa1 from pseudomonas sp.
PDB Compounds: (E:) sec-alkyl sulfatase

SCOPe Domain Sequences for d2yhee1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yhee1 d.157.1.0 (E:30-538) automated matches {Pseudomonas sp. [TaxId: 1007495]}
esldskpasaitaaknaevlknlpfadreefeaakrgliapfsgqiknaegqvvwdmgay
qflndkdaadtvnpslwrqaqlnniaglfevmpklyqvrgldpanmtiiegdsglvlidt
lttaetaraaldlyfqhrpkkpivavvyshshidhfggargiideadvkagkvkvfapsg
fmehavsenilagtamarrgqyqsgvmvprgaqaqvdsglfkttatnatntlvapnvlie
kpyerhtvdgvelefqltlgseapsdmniylpqfkvlntadnappamhnlltprgaevrd
akawagyidaslekygdrtdvliqqhnwpvwggdkvrtyladqrdmyaflnnralnlmnk
gltlheiaaevsklpgeldrkwylrsyygalstnlravyqrylgfydgnpanldpfppve
agkryveamggadavlkqmraaidkgdyrwavqlgnhlvfadpankdaralqadameqlg
yqtenalwrnmymtgamelrhgvptydsr

SCOPe Domain Coordinates for d2yhee1:

Click to download the PDB-style file with coordinates for d2yhee1.
(The format of our PDB-style files is described here.)

Timeline for d2yhee1: