SCOPe 2.07: Domain d2y7ka_: 2y7k A:

Lineage for d2y7ka_ (2y7k A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein automated matches [190140] (38 species)
   not a true protein

7. Species Burkholderia sp. [TaxId:233098] [190010] (5 PDB entries)

8. Domain d2y7ka_: 2y7k A: [207493]
   Other proteins in same PDB: d2y7kb2, d2y7kc2
   automated match to d2y7pa_
   complexed with sal

Details for d2y7ka_

PDB Entry: 2y7k, 1.95 Å

PDB Description: dntr inducer binding domain in complex with salicylate. monoclinic crystal form

PDB Compounds: (A:) LysR-type regulatory protein

SCOPe Domain Sequences for d2y7ka_:

Sequence; same for both SEQRES and ATOM records:

>d2y7ka_ c.94.1.1 (A:) automated matches {Burkholderia sp. [TaxId: 233098]}
dpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavdla
lgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghgevd
glleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpaklpd
iainlfwhakynrdpgnmwlrqlfvelfsea

Timeline for d2y7ka_:

• d2y7ka_ first appeared in SCOPe 2.03
  
• d2y7ka_ appears in SCOPe 2.06
  
• d2y7ka_ appears in the current release, SCOPe 2.08