Lineage for d2y7ka_ (2y7k A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914680Protein automated matches [190140] (37 species)
    not a true protein
  7. 2914699Species Burkholderia sp. [TaxId:233098] [190010] (5 PDB entries)
  8. 2914701Domain d2y7ka_: 2y7k A: [207493]
    Other proteins in same PDB: d2y7kb2, d2y7kc2
    automated match to d2y7pa_
    complexed with sal

Details for d2y7ka_

PDB Entry: 2y7k (more details), 1.95 Å

PDB Description: dntr inducer binding domain in complex with salicylate. monoclinic crystal form
PDB Compounds: (A:) LysR-type regulatory protein

SCOPe Domain Sequences for d2y7ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y7ka_ c.94.1.1 (A:) automated matches {Burkholderia sp. [TaxId: 233098]}
dpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavdla
lgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghgevd
glleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpaklpd
iainlfwhakynrdpgnmwlrqlfvelfsea

SCOPe Domain Coordinates for d2y7ka_:

Click to download the PDB-style file with coordinates for d2y7ka_.
(The format of our PDB-style files is described here.)

Timeline for d2y7ka_: