Class b: All beta proteins [48724] (178 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
Protein automated matches [191182] (19 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [189439] (11 PDB entries) |
Domain d2xy3b_: 2xy3 B: [207433] automated match to d2bazc_ complexed with dup, mg |
PDB Entry: 2xy3 (more details), 2.55 Å
SCOPe Domain Sequences for d2xy3b_:
Sequence, based on SEQRES records: (download)
>d2xy3b_ b.85.4.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]} mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav dlievdrl
>d2xy3b_ b.85.4.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]} mqikikyldetqtrinkmqgdwidlraaedvaikkdefklvplgvamelpegyeahvvpr sstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpavd lievdrl
Timeline for d2xy3b_: