Lineage for d2xy3b_ (2xy3 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818071Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2818270Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2818271Protein automated matches [191182] (20 species)
    not a true protein
  7. 2818279Species Bacillus subtilis [TaxId:1423] [189439] (11 PDB entries)
  8. 2818354Domain d2xy3b_: 2xy3 B: [207433]
    automated match to d2bazc_
    complexed with dup, mg

Details for d2xy3b_

PDB Entry: 2xy3 (more details), 2.55 Å

PDB Description: structure of the bacillus subtilis prophage dutpase with dupnhpp
PDB Compounds: (B:) spbc2 prophage-derived deoxyuridine 5'-triphosphate nucleotidohydrolase yoss

SCOPe Domain Sequences for d2xy3b_:

Sequence, based on SEQRES records: (download)

>d2xy3b_ b.85.4.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
dlievdrl

Sequence, based on observed residues (ATOM records): (download)

>d2xy3b_ b.85.4.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
mqikikyldetqtrinkmqgdwidlraaedvaikkdefklvplgvamelpegyeahvvpr
sstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpavd
lievdrl

SCOPe Domain Coordinates for d2xy3b_:

Click to download the PDB-style file with coordinates for d2xy3b_.
(The format of our PDB-style files is described here.)

Timeline for d2xy3b_: