Lineage for d2xxja1 (2xxj A:1-141)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1832345Species Thermus thermophilus HB8 [TaxId:300852] [187989] (16 PDB entries)
  8. 1832353Domain d2xxja1: 2xxj A:1-141 [207408]
    Other proteins in same PDB: d2xxja2, d2xxjb2, d2xxjc2, d2xxjd2
    automated match to d1llda1
    complexed with nad, oxm, so4; mutant

Details for d2xxja1

PDB Entry: 2xxj (more details), 1.96 Å

PDB Description: penta mutant of lactate dehydrogenase from thermus thermophilus, ternary complex
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2xxja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xxja1 c.2.1.0 (A:1-141) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvwag
sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
vmtqvayalsglppgrvvgsg

SCOPe Domain Coordinates for d2xxja1:

Click to download the PDB-style file with coordinates for d2xxja1.
(The format of our PDB-style files is described here.)

Timeline for d2xxja1: