SCOPe 2.08: Domain d2xwlb1: 2xwl B:2-219

Lineage for d2xwlb1 (2xwl B:2-219)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.0: automated matches [191551] (1 protein)
   not a true family

6. Protein automated matches [190951] (34 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:1772] [226120] (1 PDB entry)

8. Domain d2xwlb1: 2xwl B:2-219 [207368]
   Other proteins in same PDB: d2xwla2, d2xwlb2
   automated match to d1vgta_
   complexed with ctp, mg

Details for d2xwlb1

PDB Entry: 2xwl, 1.49 Å

PDB Description: crystal structure of ispd from mycobacterium smegmatis in complex with ctp and mg

PDB Compounds: (B:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase

SCOPe Domain Sequences for d2xwlb1:

Sequence; same for both SEQRES and ATOM records:

>d2xwlb1 c.68.1.0 (B:2-219) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
atvavvpaagsgerlragrpkafvtlggtpllehalsglrasgvidriviavppaltdes
klvfggedsvivsggvdrtesvalaleaagdaefvlvhdaaraltppaliarvvaalkeg
hsavvpglapadtikavdangavlgtperaglravqtpqgfhadvlrrayarataggvtd
daslveqlgtpvqivdgdplafkittpldlvlaeavla

Timeline for d2xwlb1:

• d2xwlb1 first appeared in SCOPe 2.03, called d2xwlb_
  
• d2xwlb1 appears in SCOPe 2.07