Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
Family c.25.1.1: Reductases [52344] (5 proteins) |
Protein automated matches [226995] (7 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [226086] (3 PDB entries) |
Domain d2xncb2: 2xnc B:140-299 [207282] Other proteins in same PDB: d2xnca1, d2xnca3, d2xncb1, d2xncb3 automated match to d1frna2 complexed with fad, so4 |
PDB Entry: 2xnc (more details), 2.9 Å
SCOPe Domain Sequences for d2xncb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xncb2 c.25.1.1 (B:140-299) automated matches {Pea (Pisum sativum) [TaxId: 3888]} mlmpkdpnatvimlgtgtgiapfrsflwkmffekhedyqfnglawlflgvptsssllyke efekmkekapenfrldfavsreqvndkgekmyiqtrmaqyaeelwellkkdntfvymcgl kgmekgiddimvslaakdgidwieykrtlkkaeqwnvevy
Timeline for d2xncb2: