SCOPe 2.08: Domain d2xnca2: 2xnc A:140-299

Lineage for d2xnca2 (2xnc A:140-299)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.1: Reductases [52344] (5 proteins)

6. Protein automated matches [226995] (7 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [226086] (3 PDB entries)

8. Domain d2xnca2: 2xnc A:140-299 [207280]
   Other proteins in same PDB: d2xnca1, d2xnca3, d2xncb1, d2xncb3
   automated match to d1frna2
   complexed with fad, so4

Details for d2xnca2

PDB Entry: 2xnc, 2.9 Å

PDB Description: crystal structure of an engineered ferredoxin nadp reductase (fnr) from pisum sativum

PDB Compounds: (A:) Ferredoxin--NADP reductase, leaf isozyme, chloroplastic

SCOPe Domain Sequences for d2xnca2:

Sequence; same for both SEQRES and ATOM records:

>d2xnca2 c.25.1.1 (A:140-299) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
mlmpkdpnatvimlgtgtgiapfrsflwkmffekhedyqfnglawlflgvptsssllyke
efekmkekapenfrldfavsreqvndkgekmyiqtrmaqyaeelwellkkdntfvymcgl
kgmekgiddimvslaakdgidwieykrtlkkaeqwnvevy

Timeline for d2xnca2:

• d2xnca2 first appeared in SCOPe 2.03
  
• d2xnca2 appears in SCOPe 2.07