| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (67 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225955] (5 PDB entries) |
| Domain d2xh2d1: 2xh2 D:1-140 [207237] Other proteins in same PDB: d2xh2a2, d2xh2b2, d2xh2c2, d2xh2d2 automated match to d1pdza2 complexed with 2pg, mg; mutant |
PDB Entry: 2xh2 (more details), 1.8 Å
SCOPe Domain Sequences for d2xh2d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xh2d1 d.54.1.0 (D:1-140) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
avskvyarsvydsrgnptvevelttekgvfrsivpsgantgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlsksk
Timeline for d2xh2d1: