Lineage for d2xh2d1 (2xh2 D:1-140)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649263Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1649264Protein automated matches [226922] (67 species)
    not a true protein
  7. 1649335Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225955] (5 PDB entries)
  8. 1649339Domain d2xh2d1: 2xh2 D:1-140 [207237]
    Other proteins in same PDB: d2xh2a2, d2xh2b2, d2xh2c2, d2xh2d2
    automated match to d1pdza2
    complexed with 2pg, mg; mutant

Details for d2xh2d1

PDB Entry: 2xh2 (more details), 1.8 Å

PDB Description: engineering the enolase active site pocket: crystal structure of the s39n d321a mutant of yeast enolase 1
PDB Compounds: (D:) enolase 1

SCOPe Domain Sequences for d2xh2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xh2d1 d.54.1.0 (D:1-140) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
avskvyarsvydsrgnptvevelttekgvfrsivpsgantgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlsksk

SCOPe Domain Coordinates for d2xh2d1:

Click to download the PDB-style file with coordinates for d2xh2d1.
(The format of our PDB-style files is described here.)

Timeline for d2xh2d1: