| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (59 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226794] (5 PDB entries) |
| Domain d2xh2c2: 2xh2 C:141-438 [207236] Other proteins in same PDB: d2xh2a1, d2xh2b1, d2xh2c1, d2xh2d1 automated match to d1pdza1 complexed with 2pg, mg; mutant |
PDB Entry: 2xh2 (more details), 1.8 Å
SCOPe Domain Sequences for d2xh2c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xh2c2 c.1.11.0 (C:141-438) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tspyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkr
ygasagnvgdeggvapniqtaeealdlivdaikaaghdgkikigldcasseffkdgkydl
dfknpnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivad
altvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgeted
tfiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkllh
Timeline for d2xh2c2: