![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein Exochitosanase CsxA [159383] (1 species) |
![]() | Species Amycolatopsis orientalis [TaxId:31958] [159384] (3 PDB entries) Uniprot Q56F26 336-674 |
![]() | Domain d2x09a3: 2x09 A:336-674 [207076] Other proteins in same PDB: d2x09a1, d2x09a2, d2x09a4, d2x09a5, d2x09b1, d2x09b2, d2x09b4, d2x09b5 automated match to d2vzsa5 complexed with cd, x09 |
PDB Entry: 2x09 (more details), 2.4 Å
SCOPe Domain Sequences for d2x09a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x09a3 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} dvkatlnssggrqysvngkpllirgggytpdlflrwnetaaadklkyvlnlglntvrleg hiepdeffdiaddlgvltmpgweccdkwegqvngeekgepwvesdypiakasmfseaerl rdhpsvisfhigsdfapdrrieqgyldamkaadfllpvipaasarpspitgasgmkmngp ydyvppvywydksqkdrggawsfnsetsagvdiptmdtlkrmmsaseldtmwknpsakqy hrsssdtfgnlklfgdaltkrygasanlndfvrkaqlsqyenvraefeshsrnytdstnp stgliywmlnspwtslhwqlfdaymdqngayygakkane
Timeline for d2x09a3: