![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
![]() | Protein Exochitosanase CsxA [158961] (1 species) |
![]() | Species Amycolatopsis orientalis [TaxId:31958] [158962] (3 PDB entries) Uniprot Q56F26 42-225 |
![]() | Domain d2x09a1: 2x09 A:49-225 [207074] Other proteins in same PDB: d2x09a2, d2x09a3, d2x09a4, d2x09a5, d2x09b2, d2x09b3, d2x09b4, d2x09b5 automated match to d2vzsa4 complexed with cd, x09 |
PDB Entry: 2x09 (more details), 2.4 Å
SCOPe Domain Sequences for d2x09a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x09a1 b.18.1.5 (A:49-225) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} gnatpipgyviqssaqvsddsavskpgfptsgwypvssrstvyagllqngkyadpfystn mqnvpaaqfsvpwwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdqvngaytr hdlditaqvhtgvnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlvrrsg
Timeline for d2x09a1: