PDB entry 2x09

View 2x09 on RCSB PDB site
Description: inhibition of the exo-beta-d-glucosaminidase csxa by a glucosamine-configured castanospermine and an amino-australine analogue
Class: hydrolase
Keywords: exo-beta-d-glucosaminidase, glycoside hydrolase, gh2, csxa, hydrolase, glycosidase
Deposited on 2009-12-07, released 2010-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-02-09, with a file datestamp of 2010-02-05.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.17934
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exo-beta-d-glucosaminidase
    Species: AMYCOLATOPSIS ORIENTALIS [TaxId:31958]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X09
      • conflict (749)
    • Uniprot Q56F26
    Domains in SCOPe 2.07: d2x09a1, d2x09a2, d2x09a3, d2x09a4, d2x09a5
  • Chain 'B':
    Compound: exo-beta-d-glucosaminidase
    Species: AMYCOLATOPSIS ORIENTALIS [TaxId:31958]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X09
      • conflict (749)
    • Uniprot Q56F26
    Domains in SCOPe 2.07: d2x09b1, d2x09b2, d2x09b3, d2x09b4, d2x09b5
  • Heterogens: X09, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x09A (A:)
    vsfrqkrtripllamtvtalaaavcgvttapaatgaevavplsvgaaagnatpipgyviq
    ssaqvsddsavskpgfptsgwypvssrstvyagllqngkyadpfystnmqnvpaaqfsvp
    wwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdqvngaytrhdlditaqvhtg
    vnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlvrrsgavalrsahviqklns
    aldhadltvkadvrndsanavqttvagtvagkpisqtvslaakerktvtfplvgldrpnv
    wwpagmggqhrydldltasvggtpsdaakskfgvrdvkatlnssggrqysvngkpllirg
    ggytpdlflrwnetaaadklkyvlnlglntvrleghiepdeffdiaddlgvltmpgwecc
    dkwegqvngeekgepwvesdypiakasmfseaerlrdhpsvisfhigsdfapdrrieqgy
    ldamkaadfllpvipaasarpspitgasgmkmngpydyvppvywydksqkdrggawsfns
    etsagvdiptmdtlkrmmsaseldtmwknpsakqyhrsssdtfgnlklfgdaltkrygas
    anlndfvrkaqlsqyenvraefeshsrnytdstnpstgliywmlnspwtslhwqlfdaym
    dqngayygakkaneplhiqyshdnrsvvvinqtsnavsgltattklynldgtekysntkt
    glsvgalgakatavtvpavsglsttylaknvltdssgkevsrnvywlstkadtlnwggsd
    wyytpqsafadlsglnnlgqsavgatansvagadgtttttvtlkntsggrlpafyvdskv
    vdsagkpvlpvewndnavslwpgetttltakyrtadlkgskpsvrisgwntgtqtvpadg
    sgpgpsdpvdyqaedativqgavesnhagytgtgfvnydnvagssvewtvtvpsagtydv
    vvryangtttsrpldfsvngsisasgvafgstgtwpawttktvrvtlaagvnkikavatt
    anggpnvdkitl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x09A (A:)
    gnatpipgyviqssaqvsddsavskpgfptsgwypvssrstvyagllqngkyadpfystn
    mqnvpaaqfsvpwwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdqvngaytr
    hdlditaqvhtgvnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlvrrsgava
    lrsahviqklnsaldhadltvkadvrndsanavqttvagtvagkpisqtvslaakerktv
    tfplvgldrpnvwwpagmggqhrydldltasvggtpsdaakskfgvrdvkatlnssggrq
    ysvngkpllirgggytpdlflrwnetaaadklkyvlnlglntvrleghiepdeffdiadd
    lgvltmpgweccdkwegqvngeekgepwvesdypiakasmfseaerlrdhpsvisfhigs
    dfapdrrieqgyldamkaadfllpvipaasarpspitgasgmkmngpydyvppvywydks
    qkdrggawsfnsetsagvdiptmdtlkrmmsaseldtmwknpsakqyhrsssdtfgnlkl
    fgdaltkrygasanlndfvrkaqlsqyenvraefeshsrnytdstnpstgliywmlnspw
    tslhwqlfdaymdqngayygakkaneplhiqyshdnrsvvvinqtsnavsgltattklyn
    ldgtekysntktglsvgalgakatavtvpavsglsttylaknvltdssgkevsrnvywls
    tkadtlnwggsdwyytpqsafadlsglnnlgqsavgatansvagadgtttttvtlkntsg
    grlpafyvdskvvdsagkpvlpvewndnavslwpgetttltakyrtadlkgskpsvrisg
    wntgtqtvpad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2x09B (B:)
    vsfrqkrtripllamtvtalaaavcgvttapaatgaevavplsvgaaagnatpipgyviq
    ssaqvsddsavskpgfptsgwypvssrstvyagllqngkyadpfystnmqnvpaaqfsvp
    wwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdqvngaytrhdlditaqvhtg
    vnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlvrrsgavalrsahviqklns
    aldhadltvkadvrndsanavqttvagtvagkpisqtvslaakerktvtfplvgldrpnv
    wwpagmggqhrydldltasvggtpsdaakskfgvrdvkatlnssggrqysvngkpllirg
    ggytpdlflrwnetaaadklkyvlnlglntvrleghiepdeffdiaddlgvltmpgwecc
    dkwegqvngeekgepwvesdypiakasmfseaerlrdhpsvisfhigsdfapdrrieqgy
    ldamkaadfllpvipaasarpspitgasgmkmngpydyvppvywydksqkdrggawsfns
    etsagvdiptmdtlkrmmsaseldtmwknpsakqyhrsssdtfgnlklfgdaltkrygas
    anlndfvrkaqlsqyenvraefeshsrnytdstnpstgliywmlnspwtslhwqlfdaym
    dqngayygakkaneplhiqyshdnrsvvvinqtsnavsgltattklynldgtekysntkt
    glsvgalgakatavtvpavsglsttylaknvltdssgkevsrnvywlstkadtlnwggsd
    wyytpqsafadlsglnnlgqsavgatansvagadgtttttvtlkntsggrlpafyvdskv
    vdsagkpvlpvewndnavslwpgetttltakyrtadlkgskpsvrisgwntgtqtvpadg
    sgpgpsdpvdyqaedativqgavesnhagytgtgfvnydnvagssvewtvtvpsagtydv
    vvryangtttsrpldfsvngsisasgvafgstgtwpawttktvrvtlaagvnkikavatt
    anggpnvdkitl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x09B (B:)
    gnatpipgyviqssaqvsddsavskpgfptsgwypvssrstvyagllqngkyadpfystn
    mqnvpaaqfsvpwwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdqvngaytr
    hdlditaqvhtgvnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlvrrsgava
    lrsahviqklnsaldhadltvkadvrndsanavqttvagtvagkpisqtvslaakerktv
    tfplvgldrpnvwwpagmggqhrydldltasvggtpsdaakskfgvrdvkatlnssggrq
    ysvngkpllirgggytpdlflrwnetaaadklkyvlnlglntvrleghiepdeffdiadd
    lgvltmpgweccdkwegqvngeekgepwvesdypiakasmfseaerlrdhpsvisfhigs
    dfapdrrieqgyldamkaadfllpvipaasarpspitgasgmkmngpydyvppvywydks
    qkdrggawsfnsetsagvdiptmdtlkrmmsaseldtmwknpsakqyhrsssdtfgnlkl
    fgdaltkrygasanlndfvrkaqlsqyenvraefeshsrnytdstnpstgliywmlnspw
    tslhwqlfdaymdqngayygakkaneplhiqyshdnrsvvvinqtsnavsgltattklyn
    ldgtekysntktglsvgalgakatavtvpavsglsttylaknvltdssgkevsrnvywls
    tkadtlnwggsdwyytpqsafadlsglnnlgqsavgatansvagadgtttttvtlkntsg
    grlpafyvdskvvdsagkpvlpvewndnavslwpgetttltakyrtadlkgskpsvrisg
    wntgtqtvpad