SCOPe 2.07: Domain d2wwpb_: 2wwp B:

Lineage for d2wwpb_ (2wwp B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.0: automated matches [191454] (1 protein)
   not a true family

6. Protein automated matches [190698] (25 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187833] (50 PDB entries)

8. Domain d2wwpb_: 2wwp B: [207057]
   automated match to d4imna_
   complexed with cl, scn

Details for d2wwpb_

PDB Entry: 2wwp, 2 Å

PDB Description: crystal structure of the human lipocalin-type prostaglandin d synthase

PDB Compounds: (B:) Prostaglandin-H2 D-isomerase

SCOPe Domain Sequences for d2wwpb_:

Sequence, based on SEQRES records:

>d2wwpb_ b.60.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsvqpnfqqdkflgrwfsaglasnsswlrekkaalsmcksvvapatdgglnltstflrkn
qcetrtmllqpagslgsysyrsphwgstysvsvvetdydqyallysqgskgpgedfrmat
lysrtqtpraelkekftafckaqgftedtivflpq

Sequence, based on observed residues (ATOM records):

>d2wwpb_ b.60.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsvqpnfqqdkflgrwfsaglasnsswllsmcksvvapatdgglnltstflrknqcetrt
mllqpagslgsysyrsphwgstysvsvvetdydqyallysqgskgpgedfrmatlysrtq
tpraelkekftafckaqgftedtivflpq

Timeline for d2wwpb_:

• d2wwpb_ first appeared in SCOPe 2.03
  
• d2wwpb_ appears in SCOPe 2.06
  
• d2wwpb_ appears in the current release, SCOPe 2.08