Class b: All beta proteins [48724] (178 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.0: automated matches [191454] (1 protein) not a true family |
Protein automated matches [190698] (25 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187833] (50 PDB entries) |
Domain d2wwpa_: 2wwp A: [207056] automated match to d4imna_ complexed with cl, scn |
PDB Entry: 2wwp (more details), 2 Å
SCOPe Domain Sequences for d2wwpa_:
Sequence, based on SEQRES records: (download)
>d2wwpa_ b.60.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vsvqpnfqqdkflgrwfsaglasnsswlrekkaalsmcksvvapatdgglnltstflrkn qcetrtmllqpagslgsysyrsphwgstysvsvvetdydqyallysqgskgpgedfrmat lysrtqtpraelkekftafckaqgftedtivflpqt
>d2wwpa_ b.60.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vsvqpnfqqdkflgrwfsaglasnsswllsmcksvvapatdgglnltstflrknqcetrt mllqpagslgsysyrsphwgstysvsvvetdydqyallysqgskgpgedfrmatlysrtq tpraelkekftafckaqgftedtivflpqt
Timeline for d2wwpa_: