Lineage for d2wwpa_ (2wwp A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2415089Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2415090Protein automated matches [190698] (25 species)
    not a true protein
  7. 2415135Species Human (Homo sapiens) [TaxId:9606] [187833] (50 PDB entries)
  8. 2415194Domain d2wwpa_: 2wwp A: [207056]
    automated match to d4imna_
    complexed with cl, scn

Details for d2wwpa_

PDB Entry: 2wwp (more details), 2 Å

PDB Description: crystal structure of the human lipocalin-type prostaglandin d synthase
PDB Compounds: (A:) Prostaglandin-H2 D-isomerase

SCOPe Domain Sequences for d2wwpa_:

Sequence, based on SEQRES records: (download)

>d2wwpa_ b.60.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsvqpnfqqdkflgrwfsaglasnsswlrekkaalsmcksvvapatdgglnltstflrkn
qcetrtmllqpagslgsysyrsphwgstysvsvvetdydqyallysqgskgpgedfrmat
lysrtqtpraelkekftafckaqgftedtivflpqt

Sequence, based on observed residues (ATOM records): (download)

>d2wwpa_ b.60.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsvqpnfqqdkflgrwfsaglasnsswllsmcksvvapatdgglnltstflrknqcetrt
mllqpagslgsysyrsphwgstysvsvvetdydqyallysqgskgpgedfrmatlysrtq
tpraelkekftafckaqgftedtivflpqt

SCOPe Domain Coordinates for d2wwpa_:

Click to download the PDB-style file with coordinates for d2wwpa_.
(The format of our PDB-style files is described here.)

Timeline for d2wwpa_: