SCOPe 2.08: Domain d2wjja_: 2wjj A:

Lineage for d2wjja_ (2wjj A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:2190] [225748] (4 PDB entries)

8. Domain d2wjja_: 2wjj A: [206854]
   automated match to d2cxxa1
   complexed with gdp

Details for d2wjja_

PDB Entry: 2wjj, 2.4 Å

PDB Description: structure and function of the feob g-domain from methanococcus jannaschii

PDB Compounds: (A:) ferrous iron transport protein b homolog

SCOPe Domain Sequences for d2wjja_:

Sequence; same for both SEQRES and ATOM records:

>d2wjja_ c.37.1.0 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
amksyeialignpnvgkstifnaltgenvyignwpgvtvekkegefeyngekfkvvdlpg
vysltansideiiardyiinekpdlvvnivdatalernlyltlqlmemganlllalnkmd
lakslgieidvdklekilgvkvvplsaakkmgieelkkaisiavkdkk

Timeline for d2wjja_:

• d2wjja_ first appeared in SCOPe 2.03
  
• d2wjja_ appears in SCOPe 2.07