Lineage for d2cxxa1 (2cxx A:2-185)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867216Protein GTP-binding protein engB [142257] (1 species)
  7. 2867217Species Pyrococcus horikoshii [TaxId:53953] [142258] (1 PDB entry)
    Uniprot O57939 28-211
    PH0200
  8. 2867218Domain d2cxxa1: 2cxx A:2-185 [131013]
    Other proteins in same PDB: d2cxxb_, d2cxxc_
    complexed with gdp

Details for d2cxxa1

PDB Entry: 2cxx (more details), 1.7 Å

PDB Description: Crystal structure of a probable GTP-binding protein engB
PDB Compounds: (A:) Probable GTP-binding protein engB

SCOPe Domain Sequences for d2cxxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]}
atiifagrsnvgkstliyrltgkkvrrgkrpgvtrkiieiewknhkiidmpgfgfmmglp
kevqerikdeivhfiednaknidvavlvvdgkaapeiikrwekrgeipidvefyqflrel
diptivavnkldkiknvqevinflaekfevplseidkvfipisakfgdnierlknrifev
irer

SCOPe Domain Coordinates for d2cxxa1:

Click to download the PDB-style file with coordinates for d2cxxa1.
(The format of our PDB-style files is described here.)

Timeline for d2cxxa1: