SCOPe 2.08: Domain d2w6pb2: 2w6p B:115-330

Lineage for d2w6pb2 (2w6p B:115-330)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)

6. Protein Biotin carboxylase (BC), domain 2 [56068] (2 species)
   subunit of acetyl-CoA and pyruvate carboxylases

7. Species Escherichia coli [TaxId:562] [56069] (24 PDB entries)

8. Domain d2w6pb2: 2w6p B:115-330 [206664]
   Other proteins in same PDB: d2w6pa1, d2w6pa3, d2w6pb1, d2w6pb3
   automated match to d1dv1a3
   complexed with oa4
   fragment; missing more than one-third of the common structure and/or sequence

Details for d2w6pb2

PDB Entry: 2w6p, 1.85 Å

PDB Description: crystal structure of biotin carboxylase from e. coli in complex with 5-methyl-6-phenyl-quinazoline-2,4-diamine

PDB Compounds: (B:) acetyl-coa carboxylase

SCOPe Domain Sequences for d2w6pb2:

Sequence, based on SEQRES records:

>d2w6pb2 d.142.1.2 (B:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg
daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr
rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq
vehpvtemitgvdlikeqlriaagqplsikqeevhv

Sequence, based on observed residues (ATOM records):

>d2w6pb2 d.142.1.2 (B:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]}
dkvsaiaamkkagvpcvpgsdgpdmvymekylenprhveiqvladgqgnaiylaerdcsm
qrrhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntr
iqvehpvtemitgvdlikeqlriaagqplsikqeevhv

Timeline for d2w6pb2:

• d2w6pb2 first appeared in SCOPe 2.03
  
• d2w6pb2 appears in SCOPe 2.07