![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
![]() | Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) ![]() |
![]() | Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins) probable rudiment form of the biotinyl-carrier domain |
![]() | Protein Biotin carboxylase (BC), C-domain [51248] (2 species) subunit of acetyl-CoA and pyruvate carboxylases |
![]() | Species Escherichia coli [TaxId:562] [51249] (24 PDB entries) |
![]() | Domain d2w6pb3: 2w6p B:331-445 [206665] Other proteins in same PDB: d2w6pa1, d2w6pa2, d2w6pb1, d2w6pb2 automated match to d1dv1a1 complexed with oa4 |
PDB Entry: 2w6p (more details), 1.85 Å
SCOPe Domain Sequences for d2w6pb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w6pb3 b.84.2.1 (B:331-445) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]} rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklg
Timeline for d2w6pb3: