Lineage for d2w6pa2 (2w6p A:115-330)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541368Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2541369Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2541397Family d.142.1.2: BC ATP-binding domain-like [56067] (7 protein domains)
  6. 2541404Protein Biotin carboxylase (BC), domain 2 [56068] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 2541407Species Escherichia coli [TaxId:562] [56069] (24 PDB entries)
  8. 2541412Domain d2w6pa2: 2w6p A:115-330 [206661]
    Other proteins in same PDB: d2w6pa1, d2w6pa3, d2w6pb1, d2w6pb3
    automated match to d1dv1a3
    complexed with oa4

Details for d2w6pa2

PDB Entry: 2w6p (more details), 1.85 Å

PDB Description: crystal structure of biotin carboxylase from e. coli in complex with 5-methyl-6-phenyl-quinazoline-2,4-diamine
PDB Compounds: (A:) acetyl-coa carboxylase

SCOPe Domain Sequences for d2w6pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w6pa2 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg
daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr
rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq
vehpvtemitgvdlikeqlriaagqplsikqeevhv

SCOPe Domain Coordinates for d2w6pa2:

Click to download the PDB-style file with coordinates for d2w6pa2.
(The format of our PDB-style files is described here.)

Timeline for d2w6pa2: