Lineage for d2w6ma1 (2w6m A:1-114)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120504Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2120505Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2120506Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 2120513Protein Biotin carboxylase (BC), N-terminal domain [52442] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 2120516Species Escherichia coli [TaxId:562] [52443] (24 PDB entries)
  8. 2120527Domain d2w6ma1: 2w6m A:1-114 [206642]
    Other proteins in same PDB: d2w6ma2, d2w6ma3, d2w6mb2, d2w6mb3
    automated match to d1dv1b2
    complexed with cl, oa1

Details for d2w6ma1

PDB Entry: 2w6m (more details), 2 Å

PDB Description: crystal structure of biotin carboxylase from e. coli in complex with amino-oxazole fragment series
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d2w6ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w6ma1 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]}
mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg

SCOPe Domain Coordinates for d2w6ma1:

Click to download the PDB-style file with coordinates for d2w6ma1.
(The format of our PDB-style files is described here.)

Timeline for d2w6ma1: