Lineage for d2w40d2 (2w40 D:255-501)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1606124Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1606125Protein automated matches [226839] (42 species)
    not a true protein
  7. 1606417Species Plasmodium falciparum [TaxId:36329] [225582] (2 PDB entries)
  8. 1606425Domain d2w40d2: 2w40 D:255-501 [206612]
    automated match to d3ezwd2
    complexed with edo, gol

Details for d2w40d2

PDB Entry: 2w40 (more details), 1.49 Å

PDB Description: crystal structure of plasmodium falciparum glycerol kinase with bound glycerol
PDB Compounds: (D:) glycerol kinase, putative

SCOPe Domain Sequences for d2w40d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w40d2 c.55.1.0 (D:255-501) automated matches {Plasmodium falciparum [TaxId: 36329]}
aifdegeakctygtgvfllintgekvvystcglitticykfndndkpkyalegsigtags
gvswllknkliddpseasdimekcenttgvifvpafsglyaprwrsdarasiygmtfnte
rshivrallegiafqlneivdsltsdmgiemlhvlrcdggmtknkpfmqfnsdiintkie
vskykevtslgaavlaglevkiwdsldsvksllrrsdavfhskmddkkrkkktsewnkav
ertliql

SCOPe Domain Coordinates for d2w40d2:

Click to download the PDB-style file with coordinates for d2w40d2.
(The format of our PDB-style files is described here.)

Timeline for d2w40d2: