Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (42 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [225582] (2 PDB entries) |
Domain d2w40b1: 2w40 B:-1-254 [206607] automated match to d1glfo1 complexed with edo, gol |
PDB Entry: 2w40 (more details), 1.49 Å
SCOPe Domain Sequences for d2w40b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w40b1 c.55.1.0 (B:-1-254) automated matches {Plasmodium falciparum [TaxId: 36329]} gsmnvilsidqstqstkvffydeelnivhsnnlnheqkclkpgwyehdpieimtnlynlm negikvlkdkytsviikcigitnqretviiwdritgkplynaivwldtrveelvtefsak ynnndiqkktgtyfntyfsafkilwliqnnpeikqkiddgtavignintwlifnltkgnc ytdvtnasrtllmdintlqwdekmckifnitnmsvlpeiksncsnfglvksehvpdylni pitgcigdqqsacigq
Timeline for d2w40b1: