Lineage for d2w27a2 (2w27 A:263-407)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1665312Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1665912Superfamily d.110.6: Sensory domain-like [103190] (3 families) (S)
    alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain
  5. 1665937Family d.110.6.2: YkuI C-terminal domain-like [143732] (2 proteins)
    PfamB PB021678
  6. 1665952Protein Hypothetical protein YkuI, C-terminal domain [143733] (1 species)
  7. 1665953Species Bacillus subtilis [TaxId:1423] [143734] (2 PDB entries)
    Uniprot O35014 263-407
  8. 1665956Domain d2w27a2: 2w27 A:263-407 [206568]
    Other proteins in same PDB: d2w27a1, d2w27b1
    automated match to d2basa2
    complexed with 5gp, ca

Details for d2w27a2

PDB Entry: 2w27 (more details), 2.8 Å

PDB Description: crystal structure of the bacillus subtilis ykui protein, with an eal domain, in complex with substrate c-di-gmp and calcium
PDB Compounds: (A:) YkuI protein

SCOPe Domain Sequences for d2w27a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w27a2 d.110.6.2 (A:263-407) Hypothetical protein YkuI, C-terminal domain {Bacillus subtilis [TaxId: 1423]}
kkletvyehseqfykrvhqavtslrknnlssdddfikklaeeltdcsfriymcdeegdql
tgnvfkqdgewiyqpeyaeknwswrpyflenimrmrnlrkgffsdlysdletgemirtfs
ypmddqmylfidlpysylyeqdgli

SCOPe Domain Coordinates for d2w27a2:

Click to download the PDB-style file with coordinates for d2w27a2.
(The format of our PDB-style files is described here.)

Timeline for d2w27a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2w27a1