SCOPe 2.08: Domain d2w27a2: 2w27 A:263-407

Lineage for d2w27a2 (2w27 A:263-407)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.6: Sensory domain-like [103190] (5 families)
   alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain

5. Family d.110.6.2: YkuI C-terminal domain-like [143732] (3 proteins)
   PfamB PB021678

6. Protein Hypothetical protein YkuI, C-terminal domain [143733] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [143734] (2 PDB entries)
   Uniprot O35014 263-407

8. Domain d2w27a2: 2w27 A:263-407 [206568]
   Other proteins in same PDB: d2w27a1, d2w27b1
   automated match to d2basa2
   complexed with 5gp, ca

Details for d2w27a2

PDB Entry: 2w27, 2.8 Å

PDB Description: crystal structure of the bacillus subtilis ykui protein, with an eal domain, in complex with substrate c-di-gmp and calcium

PDB Compounds: (A:) YkuI protein

SCOPe Domain Sequences for d2w27a2:

Sequence; same for both SEQRES and ATOM records:

>d2w27a2 d.110.6.2 (A:263-407) Hypothetical protein YkuI, C-terminal domain {Bacillus subtilis [TaxId: 1423]}
kkletvyehseqfykrvhqavtslrknnlssdddfikklaeeltdcsfriymcdeegdql
tgnvfkqdgewiyqpeyaeknwswrpyflenimrmrnlrkgffsdlysdletgemirtfs
ypmddqmylfidlpysylyeqdgli

Timeline for d2w27a2:

• d2w27a2 first appeared in SCOPe 2.03
  
• d2w27a2 appears in SCOPe 2.07