Lineage for d2vxya1 (2vxy A:11-208)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121563Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2121564Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2121981Family c.32.1.0: automated matches [227136] (1 protein)
    not a true family
  6. 2121982Protein automated matches [226838] (4 species)
    not a true protein
  7. 2121983Species Bacillus subtilis [TaxId:1423] [225338] (3 PDB entries)
  8. 2121984Domain d2vxya1: 2vxy A:11-208 [206532]
    Other proteins in same PDB: d2vxya2
    automated match to d1rq2a1
    complexed with cit, k

Details for d2vxya1

PDB Entry: 2vxy (more details), 1.7 Å

PDB Description: the structure of ftsz from bacillus subtilis at 1.7a resolution
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d2vxya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vxya1 c.32.1.0 (A:11-208) automated matches {Bacillus subtilis [TaxId: 1423]}
lasikvigvggggnnavnrmienevqgveyiavntdaqalnlskaevkmqigakltrglg
aganpevgkkaaeeskeqieealkgadmvfvtagmgggtgtgaapviaqiakdlgaltvg
vvtrpftfegrkrqlqaaggisamkeavdtlivipndrileivdkntpmleafreadnvl
rqgvqgisdliatpglin

SCOPe Domain Coordinates for d2vxya1:

Click to download the PDB-style file with coordinates for d2vxya1.
(The format of our PDB-style files is described here.)

Timeline for d2vxya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vxya2