SCOPe 2.05: Domain d2vxya1: 2vxy A:11-208

Lineage for d2vxya1 (2vxy A:11-208)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.0: automated matches [227136] (1 protein)
   not a true family

6. Protein automated matches [226838] (4 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [225338] (3 PDB entries)

8. Domain d2vxya1: 2vxy A:11-208 [206532]
   Other proteins in same PDB: d2vxya2
   automated match to d1rq2a1
   complexed with cit, k

Details for d2vxya1

PDB Entry: 2vxy, 1.7 Å

PDB Description: the structure of ftsz from bacillus subtilis at 1.7a resolution

PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d2vxya1:

Sequence; same for both SEQRES and ATOM records:

>d2vxya1 c.32.1.0 (A:11-208) automated matches {Bacillus subtilis [TaxId: 1423]}
lasikvigvggggnnavnrmienevqgveyiavntdaqalnlskaevkmqigakltrglg
aganpevgkkaaeeskeqieealkgadmvfvtagmgggtgtgaapviaqiakdlgaltvg
vvtrpftfegrkrqlqaaggisamkeavdtlivipndrileivdkntpmleafreadnvl
rqgvqgisdliatpglin

Timeline for d2vxya1:

• d2vxya1 first appeared in SCOPe 2.03
  
• d2vxya1 appears in SCOPe 2.04
  
• d2vxya1 appears in SCOPe 2.06
  
• d2vxya1 appears in the current release, SCOPe 2.08