Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.0: automated matches [191354] (1 protein) not a true family |
Protein automated matches [190388] (30 species) not a true protein |
Species Escherichia coli [TaxId:562] [225481] (1 PDB entry) |
Domain d2veca_: 2vec A: [206340] automated match to d1tq5a1 complexed with cl |
PDB Entry: 2vec (more details), 1.85 Å
SCOPe Domain Sequences for d2veca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2veca_ b.82.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]} arqcgqadygwlqarytfsfghyfdpkllgyaslrvlnqevlapgaafqprtypkvdiln vildgeaeyrdsegnhvqasagealllstqpgvsysehnlskdkpltrmqlwldacpqre npliqklalnmgkqqliaspegamgslqlrqqvwlhhivldkgesanfqlhgpraylqsi hgkfhalthheekaaltcgdgafirdeanitlvadsplrallidlpv
Timeline for d2veca_: