Lineage for d2veca_ (2vec A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2815203Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2815204Protein automated matches [190388] (30 species)
    not a true protein
  7. 2815249Species Escherichia coli [TaxId:562] [225481] (1 PDB entry)
  8. 2815250Domain d2veca_: 2vec A: [206340]
    automated match to d1tq5a1
    complexed with cl

Details for d2veca_

PDB Entry: 2vec (more details), 1.85 Å

PDB Description: the crystal structure of the protein yhak from escherichia coli
PDB Compounds: (A:) pirin-like protein yhak

SCOPe Domain Sequences for d2veca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2veca_ b.82.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
arqcgqadygwlqarytfsfghyfdpkllgyaslrvlnqevlapgaafqprtypkvdiln
vildgeaeyrdsegnhvqasagealllstqpgvsysehnlskdkpltrmqlwldacpqre
npliqklalnmgkqqliaspegamgslqlrqqvwlhhivldkgesanfqlhgpraylqsi
hgkfhalthheekaaltcgdgafirdeanitlvadsplrallidlpv

SCOPe Domain Coordinates for d2veca_:

Click to download the PDB-style file with coordinates for d2veca_.
(The format of our PDB-style files is described here.)

Timeline for d2veca_: