PDB entry 2vec

View 2vec on RCSB PDB site
Description: the crystal structure of the protein yhak from escherichia coli
Class: cytosolic protein
Keywords: ros, bicupin, sulfenic acid, reactive cysteine, cytosolic protein
Deposited on 2007-10-18, released 2008-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.183
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pirin-like protein yhak
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VEC
    • Uniprot P42624 (Start-255)
    Domains in SCOPe 2.07: d2veca_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vecA (A:)
    mhhhhhhgtslykkagsenlyfqgittrtarqcgqadygwlqarytfsfghyfdpkllgy
    aslrvlnqevlapgaafqprtypkvdilnvildgeaeyrdsegnhvqasagealllstqp
    gvsysehnlskdkpltrmqlwldacpqrenpliqklalnmgkqqliaspegamgslqlrq
    qvwlhhivldkgesanfqlhgpraylqsihgkfhalthheekaaltcgdgafirdeanit
    lvadsplrallidlpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vecA (A:)
    arqcgqadygwlqarytfsfghyfdpkllgyaslrvlnqevlapgaafqprtypkvdiln
    vildgeaeyrdsegnhvqasagealllstqpgvsysehnlskdkpltrmqlwldacpqre
    npliqklalnmgkqqliaspegamgslqlrqqvwlhhivldkgesanfqlhgpraylqsi
    hgkfhalthheekaaltcgdgafirdeanitlvadsplrallidlpv