SCOPe 2.08: Domain d2vd3b2: 2vd3 B:213-287

Lineage for d2vd3b2 (2vd3 B:213-287)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.0: automated matches [191474] (1 protein)
   not a true family

6. Protein automated matches [190753] (21 species)
   not a true protein

7. Species Methanobacterium thermoautotrophicum [TaxId:187420] [225550] (1 PDB entry)

8. Domain d2vd3b2: 2vd3 B:213-287 [206335]
   Other proteins in same PDB: d2vd3a1, d2vd3b1
   automated match to d1h3da2
   complexed with cl, his, imd, mg, mpd, mrd

Details for d2vd3b2

PDB Entry: 2vd3, 2.45 Å

PDB Description: the structure of histidine inhibited hisg from methanobacterium thermoautotrophicum

PDB Compounds: (B:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d2vd3b2:

Sequence; same for both SEQRES and ATOM records:

>d2vd3b2 d.58.5.0 (B:213-287) automated matches {Methanobacterium thermoautotrophicum [TaxId: 187420]}
gkrlvmlnidrknldrvralmpgmtgptvsevlsdngvvavhavvdekevfnlinrlkav
gardilvvpieriip

Timeline for d2vd3b2:

• d2vd3b2 first appeared in SCOPe 2.03
  
• d2vd3b2 appears in SCOPe 2.07