Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (161 species) not a true protein |
Species Methanobacterium thermoautotrophicum [TaxId:187420] [225549] (1 PDB entry) |
Domain d2vd3a1: 2vd3 A:-1-212 [206332] Other proteins in same PDB: d2vd3a2, d2vd3b2 automated match to d1h3da1 complexed with cl, his, imd, mg, mpd, mrd |
PDB Entry: 2vd3 (more details), 2.45 Å
SCOPe Domain Sequences for d2vd3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vd3a1 c.94.1.0 (A:-1-212) automated matches {Methanobacterium thermoautotrophicum [TaxId: 187420]} avpkiriavpskgrisepairllenagvglkdtvnrklfsktqhpqievmfsraadipef vadgaadlgitgydlivergsdveiledlkygraslvlaapedstirgpediprgaviat efpgitenylrehgidaevveltgsteiapfigvadlitdlsstgttlrmnhlrvidtil essvklianresyatksgiieelrtgirgvidae
Timeline for d2vd3a1: