Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
Protein automated matches [190753] (7 species) not a true protein |
Species Methanobacterium thermoautotrophicum [TaxId:187420] [225550] (1 PDB entry) |
Domain d2vd3b2: 2vd3 B:213-287 [206335] Other proteins in same PDB: d2vd3a1, d2vd3b1 automated match to d1h3da2 complexed with cl, his, imd, mg, mpd, mrd |
PDB Entry: 2vd3 (more details), 2.45 Å
SCOPe Domain Sequences for d2vd3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vd3b2 d.58.5.0 (B:213-287) automated matches {Methanobacterium thermoautotrophicum [TaxId: 187420]} gkrlvmlnidrknldrvralmpgmtgptvsevlsdngvvavhavvdekevfnlinrlkav gardilvvpieriip
Timeline for d2vd3b2: