SCOPe 2.04: Domain d2v9ya2: 2v9y A:600-792

Lineage for d2v9ya2 (2v9y A:600-792)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.0: automated matches [227182] (1 protein)
   not a true family

6. Protein automated matches [226902] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225336] (1 PDB entry)

8. Domain d2v9ya2: 2v9y A:600-792 [206273]
   Other proteins in same PDB: d2v9ya1, d2v9yb1
   automated match to d1clia2
   complexed with so4

Details for d2v9ya2

PDB Entry: 2v9y, 2.1 Å

PDB Description: human aminoimidazole ribonucleotide synthetase

PDB Compounds: (A:) phosphoribosylformylglycinamidine cyclo-ligase

SCOPe Domain Sequences for d2v9ya2:

Sequence, based on SEQRES records:

>d2v9ya2 d.139.1.0 (A:600-792) automated matches {Human (Homo sapiens) [TaxId: 9606]}
phleritegdvvvgiassglhsngfslvrkivaksslqysspapdgcgdqtlgdllltpt
riyshsllpvlrsghvkafahitggglleniprvlpeklgvdldaqtwriprvfswlqqe
ghlseeemartfncgvgavlvvskeqteqilrgiqqhkeeawvigsvvaraegsprvkvk
nliesmqingsvl

Sequence, based on observed residues (ATOM records):

>d2v9ya2 d.139.1.0 (A:600-792) automated matches {Human (Homo sapiens) [TaxId: 9606]}
phleritegdvvvgiassglhsngfslvrkivaksslqysspapdgcgdqtlgdllltpt
riyshsllpvlrsghvkafahitggglleniprvlpeklgvdldaqtwriprvfswlqqe
ghlseeemartfncgvgavlvvskeqteqilrgiqqhkeeawvigsvvarprvkvknlie
smqingsvl

Timeline for d2v9ya2:

• d2v9ya2 first appeared in SCOPe 2.03
  
• d2v9ya2 appears in SCOPe 2.05
  
• d2v9ya2 appears in the current release, SCOPe 2.08