Lineage for d2v9ya1 (2v9y A:475-599)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1657490Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1658121Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 1658193Family d.79.4.0: automated matches [227181] (1 protein)
    not a true family
  6. 1658194Protein automated matches [226901] (6 species)
    not a true protein
  7. 1658206Species Human (Homo sapiens) [TaxId:9606] [225335] (1 PDB entry)
  8. 1658207Domain d2v9ya1: 2v9y A:475-599 [206272]
    Other proteins in same PDB: d2v9ya2, d2v9yb2
    automated match to d1clia1
    complexed with so4

Details for d2v9ya1

PDB Entry: 2v9y (more details), 2.1 Å

PDB Description: human aminoimidazole ribonucleotide synthetase
PDB Compounds: (A:) phosphoribosylformylglycinamidine cyclo-ligase

SCOPe Domain Sequences for d2v9ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v9ya1 d.79.4.0 (A:475-599) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glfdlkaagfkdpllasgtdgvgtklkiaqlcnkhdtigqdlvamcvndilaqgaeplff
ldyfscgkldlsvteavvagiakacgkagcallggetaempdmyppgeydlagfavgame
rdqkl

SCOPe Domain Coordinates for d2v9ya1:

Click to download the PDB-style file with coordinates for d2v9ya1.
(The format of our PDB-style files is described here.)

Timeline for d2v9ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2v9ya2