Lineage for d2v6ba1 (2v6b A:22-164)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2094848Species Deinococcus radiodurans [TaxId:1299] [225329] (1 PDB entry)
  8. 2094849Domain d2v6ba1: 2v6b A:22-164 [206239]
    Other proteins in same PDB: d2v6ba2, d2v6bb2, d2v6bc2, d2v6bd2
    automated match to d1llda1

Details for d2v6ba1

PDB Entry: 2v6b (more details), 2.5 Å

PDB Description: crystal structure of lactate dehydrogenase from deinococcus radiodurans (apo form)
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2v6ba1:

Sequence, based on SEQRES records: (download)

>d2v6ba1 c.2.1.0 (A:22-164) automated matches {Deinococcus radiodurans [TaxId: 1299]}
mkvgvvgtgfvgstaafalvlrgscselvlvdrdedraqaeaediahaapvshgtrvwhg
ghseladaqvviltaganqkpgesrldlleknadifrelvpqitraapdavllvtsnpvd
lltdlatqlapgqpvigsg

Sequence, based on observed residues (ATOM records): (download)

>d2v6ba1 c.2.1.0 (A:22-164) automated matches {Deinococcus radiodurans [TaxId: 1299]}
mkvgvvgtgfvgstaafalvlrgscselvlvdrdedraqaeaediahaapvshgtrvwhg
ghseladaqvviltalleknadifrelvpqitraapdavllvtsnpvdlltdlatqlapg
qpvigsg

SCOPe Domain Coordinates for d2v6ba1:

Click to download the PDB-style file with coordinates for d2v6ba1.
(The format of our PDB-style files is described here.)

Timeline for d2v6ba1: